PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa15g072280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 435aa    MW: 48985.9 Da    PI: 10.3348
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa15g072280.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.12.4e-16693197
                    EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                    ffk l     + s+ l++p  f+ ++ +g +e++kt  l++  s  +W+vk+  ++++    l++GWkeF+ a++L+ gD++vFk +++++f  +v+
  Csa15g072280.1  6 FFKPL--LPGFHSH-LTIPVAFFLKNiEGRNEQKKTAELRSdASKITWKVKV--DGQR----LSNGWKEFALAHDLRIGDILVFKQERDMCF--HVT 91
                    66666..5667777.*******9999977788999****9968889******..9888....***********************8888999..777 PP

                    EE CS
              B3 96 vf 97
                    v+
  Csa15g072280.1 92 VL 93
                    65 PP

2B3795e-25137222390
                     EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                      + +++++l+ + l+lp +f++++g++++++ + +l+ e+grsW+v l+ +k+ g++++++GW++F++angL++gDf++Fkl++r ++
  Csa15g072280.1 137 VANVTPSNLRYDSLTLPMSFVRANGLDTRCG-EKILMREKGRSWTVSLKRKKSCGTTYIRGGWRSFCQANGLRAGDFLTFKLIQR-GG 222
                     56789999*******************9998.5666788*********98999999**************************996.33 PP

3B3551.5e-17263350190
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f++v++++++ +++ l+lp +f++ +g++k++  ++++ d++g +W+ ++ ++  ++r+ lt+GWke ++a g+k g++++++l++  ++
  Csa15g072280.1 263 FVTVTLTPYNIRESKLTLPIPFTKVNGLQKAK--KMSFLDKHGVKWSTNMGFEVERKRMRLTGGWKEVCNASGVKIGESIILELVWGADR 350
                     789999***********************765..8************************************************9987444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.14E-193102IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.2E-223108IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.646396IPR003340B3 DNA binding domain
CDDcd100173.47E-15593No hitNo description
SMARTSM010193.4E-24696IPR003340B3 DNA binding domain
PfamPF023623.3E-111492IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.9E-24128221IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.02E-22133224IPR015300DNA-binding pseudobarrel domain
CDDcd100179.36E-25135228No hitNo description
PROSITE profilePS5086316.017135232IPR003340B3 DNA binding domain
SMARTSM010195.5E-31136232IPR003340B3 DNA binding domain
PfamPF023626.7E-24137223IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-18255348IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019365.69E-17259347IPR015300DNA-binding pseudobarrel domain
CDDcd100172.88E-13262347No hitNo description
SMARTSM010194.9E-15263357IPR003340B3 DNA binding domain
PROSITE profilePS5086313.07263362IPR003340B3 DNA binding domain
PfamPF023626.5E-17263350IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MANQHFFKPL LPGFHSHLTI PVAFFLKNIE GRNEQKKTAE LRSDASKITW KVKVDGQRLS  60
NGWKEFALAH DLRIGDILVF KQERDMCFHV TVLGPSCCQI QYVSSLHNQN NLVSSFSGKI  120
QRKKEKSESS LDLSCFVANV TPSNLRYDSL TLPMSFVRAN GLDTRCGEKI LMREKGRSWT  180
VSLKRKKSCG TTYIRGGWRS FCQANGLRAG DFLTFKLIQR GGTLGLRISP GEIEEEEDCL  240
SEGNVVKSRS IWKASSSESQ NRFVTVTLTP YNIRESKLTL PIPFTKVNGL QKAKKMSFLD  300
KHGVKWSTNM GFEVERKRMR LTGGWKEVCN ASGVKIGESI ILELVWGADR SSVLKTMVEQ  360
LKSAHARLVS SQYSMKSSSI WRGRTTVSML FMLALQLIEI LISLSYVLVT PNLFSSLVES  420
KDLCTLEKIP VFLF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010467375.10.0PREDICTED: B3 domain-containing protein REM14-like
SwissprotQ8GYM41e-117REM14_ARATH; B3 domain-containing protein REM14
TrEMBLR0HUY20.0R0HUY2_9BRAS; Uncharacterized protein (Fragment)
STRINGscaffold_400948.11e-174(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.11e-116B3 family protein